Roten meaning

Entry 1 of 4 1 : the use of memory usually with little intelligence learn by rote 2 : mechanical or unthinking routine or repetition a joyless sense of order, roteand commercial hustle — L. King rote. Accessed 10 Oct. Keep scrolling for more More Definitions for rote rote. Please tell us where you read or heard it including the quote, if possible.

Test Your Vocabulary Forms of Government Quiz A gerontocracy is rule by: soothsayers elders unwritten laws animals Can you spell these 10 commonly misspelled words? Test Your Knowledge - and learn some interesting things along the way. Subscribe to America's largest dictionary and get thousands more definitions and advanced search—ad free!

roten meaning

Convening on 'Counsel' and 'Council' We drop the gavel. Ask the Editors 'Intensive purposes': An Eggcorn We're intent on clearing it up 'Nip it in the butt': An Eggcorn We're gonna stop you right there Literally How to use a word that literally drives some pe Is Singular 'They' a Better Choice? Or something like that. A challenging quiz of changing words. Can you spell these 10 commonly misspelled words?

Build a city of skyscrapers—one synonym at a time. Login or Register. Save Word. Other Words from rote Adjective rotely adverb. First Known Use of rote Noun 1 14th century, in the meaning defined at sense 1 Adjectivein the meaning defined at sense 1 Noun 2 14th century, in the meaning defined above Noun 3in the meaning defined above.

Keep scrolling for more. Learn More about rote. Time Traveler for rote The first known use of rote was in the 14th century See more words from the same century.

Statistics for rote Look-up Popularity. More Definitions for rote. Kids Definition of rote. Comments on rote What made you want to look up rote? Get Word of the Day daily email!

Test Your Vocabulary. Love words? Need even more definitions? The awkward case of 'his or her'. Take the quiz Semantic Drift Quiz A challenging quiz of changing words.

Take the quiz Spell It Can you spell these 10 commonly misspelled words? Take the quiz Syn City Build a city of skyscrapers—one synonym at a time. Play the game.Being in a state of putrefaction or decay; decomposed. Made weak or unsound by rot: rotten floorboards. Morally corrupt or despicable: She's rotten to the core.

Very bad; wretched: rotten weather. To a very great degree: The child is spoiled rotten. All rights reserved. Biochemistry affected with rot; decomposing, decaying, or putrid. Geological Science of rocks, soils, etc soft and crumbling, esp as a result of weathering. Copyright, by Random House, Inc. Switch to new thesaurus. Based on WordNet 3. Informal baddisappointingunfortunateunluckyregrettabledeplorable What rotten luck! Informal despicablemeanbasedirtynastyunpleasantfilthyvilewickeddisagreeablecontemptiblescurrilousshitty taboo slang You rotten swine!

Informal unwellpoorly informalillsickrough informalbadcrook Austral. Informal inferiorpoorsorryinadequateunacceptablepunkduff Brit.

Smelling of mildew or decay: frowzyfustymoldymustyputridrancidrank. Impaired because of decay: badputrid. Utterly reprehensible in nature or behavior: corruptdegeneratedepravedflagitiousmiscreantperverseunhealthyvillainous.

So objectionable as to elicit despisal or deserve condemnation: abhorrentabominableantipatheticcontemptibledespicabledespisabledetestabledisgustingfilthyfoulinfamousloathsomelousylowmeannastynefariousobnoxiousodiousrepugnantshabbyvilewretched. Of decidedly inferior quality: basecheaplousymiserablepaltrypoorshoddysleazytrashy. Slang: crummyschlocky.

ADJ 1. The fruit is rotting on the ground; Water rots wood. The floorboards are affected by rot. Don't talk rot! What rotten luck! Mentioned in? References in classic literature? View in context. Brooke, taking up the paper and trying to bear the attack as easily as his neighbor did, but coloring and smiling rather nervously; "that about roaring himself red at rotten boroughs--I never made a speech about rotten boroughs in my life. Send no lunge beyond thy length; Lend no rotten bough thy strength.

He went to a rotten log near at hand and began to dig under one end of it with his Barlow knife. Tom's most well now, and got his bullet around his neck on a watch-guard for a watch, and is always seeing what time it is, and so there ain't nothing more to write about, and I am rotten glad of it, because if I'd a knowed what a trouble it was to make a book I wouldn't a tackled it, and ain't a-going to no more. With a single, low: "For the Princess of Helium! The run-way still ran through the dank and rotten jungle, and they knew no villages would be encountered till rising ground was gained.

Pay its price to-day, and it would shift its present rotten policy to some other rotten policy; but it would never let up on morality and civic duty. What do you want in these sick and rotten cities of men?

Dictionary browser?Reports out of Los Angeles indicate mail delays have led to rotten food and even dead animals. It has grown from a rotten root—striving to replace human judgment with detailed dictates.

Which to me, after the initial explosion of the Sex Pistols, always made Rotten kind of boring. Yeonmi had been hospitalized at the time for a stomach illness, likely from her diet of rotten potatoes. Fittingly to that point, its Rotten Tomato score as of Tuesday evening was a flat 50 percent.

They know this is a rotten deal and they are demoralized, running faster and faster with no hope of catching up. She really was a splendid animal, unhurt either by excessive work or—as many modern mothers are—by a rotten fashionable life. Why should not a bit of rotten malaria act in a similar manner within the human frame?

After the burial of the rotten boroughs came the railway, and a long time after the railway the artists and authors. The examination of rotten sheep is not altogether free from danger. They are built on piles of wood, running out to some distance in the water, and covered with rottenblack-looking boards. Australian Slang. Find out with this quiz on words that originate from American Indigenous languages. Words nearby rotten rototillrototillerrototomerotovaterotproofrottenrotten applerotten boroughrotten eggrotten icerottenstone.

Words related to rotten putridrottingdisgustingrancidnoxioussourspoiledcorruptmoldystaleoverripecrookedunpleasantunluckylousydiseasedcrummyamissnastydirty.

roten meaning

Life on Earth may have begun in hostile hot springs Jack J. Lee September 24, Science News. Stinky success: Scientists identify the chemistry of B. Here and Hereafter Barry Pain. Fragments of science, V. Highways and Byways in Surrey Eric Parker.Swiss German: variant spelling of Rothen, recorded in as the surname of a Swiss Mennonite immigrant.

It is probably topographic in origin, from a field or rocky slope so named due to the red color of the soil or rock.

Simply start with a family member and we'll do the searching for you. View Census Data for Roten. Some less common occupations for Americans named Roten were Salesman and Bookkeeper. View Census data for Roten Data not to scale. There are 5, census records available for the last name Roten. Like a window into their day-to-day life, Roten census records can tell you where and how your ancestors worked, their level of education, veteran status, and more.

There are immigration records available for the last name Roten. Passenger lists are your ticket to knowing when your ancestors arrived in the USA, and how they made the journey - from the ship name to ports of arrival and departure. There are 4, military records available for the last name Roten. For the veterans among your Roten ancestors, military collections provide insights into where and when they served, and even physical descriptions. Between andin the United States, Roten life expectancy was at its lowest point inand highest in The average life expectancy for Roten in was 45, and 71 in Browse profiles of historical people with the Roten last name.

This page needs Javascript enabled in order to work properly. Click here for instructions on how to enable it in your browse.

Ready to discover your family story? First Name. Last Name. You can see how Roten families moved over time by selecting different census years. The most Roten families were found in the USA in In there were 6 Roten families living in Tennessee. Tennessee had the highest population of Roten families in Add rote to one of your lists below, or create a new one.

Soft spots and big guns Idioms and phrases in newspapers. Definitions Clear explanations of natural written and spoken English. Click on the arrows to change the translation direction. Follow us. Choose a dictionary. Clear explanations of natural written and spoken English.

Usage explanations of natural written and spoken English. Word Lists. Choose your language. My word lists. Tell us about this example sentence:. The word in the example sentence does not match the entry word. The sentence contains offensive content. Cancel Submit. Your feedback will be reviewed. Types of education. You can also find related words, phrases, and synonyms in the topics: Memory and memories.

Idiom learn sth by rote. She learned multiplication by rote.Add rotten to one of your lists below, or create a new one. Soft spots and big guns Idioms and phrases in newspapers. Definitions Clear explanations of natural written and spoken English. Click on the arrows to change the translation direction.

Follow us. Choose a dictionary. Clear explanations of natural written and spoken English. Usage explanations of natural written and spoken English. Word Lists. Choose your language. My word lists. Tell us about this example sentence:. The word in the example sentence does not match the entry word. The sentence contains offensive content. Cancel Submit. Your feedback will be reviewed. B2 decayed :. The room smelled of rotten vegetables.

The lizards live in cooldark places such as rotten logs. The bins were full of rotten food. The birds feed on insects and rotten meat. The crowd threw stones and rotten eggs at the politician. The gas has a smell like rotten eggs. Not pleasant to eat or drink. You can also find related words, phrases, and synonyms in the topics: Decaying and staying fresh.

Serious and unpleasant. Idiom be rotten to the core.

See at rot. Rotten also means bad :. Examples of rotten. Rotten's vocals and the music and the compositions have gelled together.

From Wikipedia. In addition, frugivorous butterflies feed obligately on ripe and rotten fruit, and therefore can be efficiently censused using the bait-trapping method see below. From the Cambridge English Corpus.

These examples are from the Cambridge English Corpus and from sources on the web. Any opinions in the examples do not represent the opinion of the Cambridge Dictionary editors or of Cambridge University Press or its licensors.

Here, half a century ago, nationalism was ripped out of a remarkably obstinate population like a rotten tooth. The traps were baited with rotten plantains and rum and left for h between 09h30 and 15h Rotten's re-issue kept the original art intact.National Health Service sites are usually very reputable because they are in turn linked-to from other online authority websites.

As such an ideal link to get to increase the trust and reputation of your own site. NHS and Health Service Site links are an excellent link building opportunity for those where it is practical. Well, you live somewhere.

roten meaning

You live in a town or a city, in a region, in a wider region. Live in the wilderness.

roten meaning

Look at your nearest city. See what I did there. So while your competitors are off buying links on crap third world domain hosting companies, submitting to 100,000 useless search engines, submitting to 100 useless directories, spamming dofollow blogs and forums or hiring a social media consultant to get 10,000 non-paying visitors from Stumbleupon or Facebook etc. And all these kind of links above can be mixed and match to a national campaign if you know how to scale your efforts in a sensible manner.

When you build a wall, you do it bit by bit, with the same kind of identical bricks until you have a lot of bricks that all look the same presto, you have a wall.

We are an expert link building company. Stop thinking about building links.

Start thinking of creating and promoting useful content. I love picking up media links. The best way to get them is to be an authority on a subject, and that usually means WRITING posts that illustrate some expertise on the matter. Legitimate PR is one of the most valuable assets in your link earning strategy. Media links are often as good as links get, in terms of quality. The best media links are organic media links generated from some sort of PR or content production.

Not exactly rocket science is it. You should avoid unnatural links. Back To Table Of ContentsIs your website ready to build links to. If it's not - link building will NOT have the same affect as it did a few years ago. And if you do not build the 'right' links, you will soon find your website penalised and potentially removed from Google.

I can review your website and look for less risky ways to drive more traffic to your site.


Comments

Leave a Reply

Your email address will not be published. Required fields are marked *